MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Guinea Pig, Human |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Guinea Pig, Human |
Rabbit polyclonal MITF (Ab-180/73) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit polyclonal MITF (Ser180/73) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MITF around the phosphorylation site of serine 73 (P-N-SP-P-M). |
Modifications | Phospho-specific |
Rabbit Polyclonal MITF (Ser180/73) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF around the phosphorylation site of Serine 180/73 |
Modifications | Phospho-specific |
Rabbit Polyclonal MITF Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF |
Rabbit Polyclonal Anti-MITF Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MITF antibody: synthetic peptide directed towards the middle region of human MITF. Synthetic peptide located within the following region: MGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC |
MITF Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MITF |
Rabbit Polyclonal anti-MITF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MITF antibody is: synthetic peptide directed towards the middle region of Human MITF. Synthetic peptide located within the following region: NSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSY |
Rabbit Polyclonal Anti-MITF Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MITF antibody: synthetic peptide directed towards the N terminal of human MITF. Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP |
Anti-MITF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28 |