Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CIR1 antibody is: synthetic peptide directed towards the middle region of Human CIR1. Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK

Rabbit Polyclonal Anti-CIR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CIR antibody: synthetic peptide directed towards the middle region of human CIR. Synthetic peptide located within the following region: SGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLR

Rabbit Polyclonal Anti-CIR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CIR antibody: synthetic peptide directed towards the C terminal of human CIR. Synthetic peptide located within the following region: RSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPG