Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-Lamin B1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 572 of mouse Lamin B1 |
Rabbit Polyclonal Anti-LMNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMNB1 antibody: synthetic peptide directed towards the middle region of human LMNB1. Synthetic peptide located within the following region: EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
Rabbit anti Lamin B Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Lamin B1 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Lamin B1 |
| Modifications | Unmodified |
Lamin B1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Lamin B1 |
Lamin B1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Lamin B1 . |
Active filters
Target Symbol
- LMNB1
Reactivities
- Human
Isotypes
- IgG