Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit Polyclonal Anti-PDHA1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP |
Rabbit polyclonal anti-PDHA1 antibody
Applications | IHC, WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDHA1. |
Rabbit Polyclonal antibody to Pyruvate Dehydrogenase E1 alpha (pyruvate dehydrogenase (lipoamide) alpha 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 325 of (Uniprot ID#P08559) |
Anti-PDHA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
PDHA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDHA1 |
PDHA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDHA1 |
PDHA1 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1. |
Modifications | Unmodified |
Phospho-PDHA1-S293 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S293 of human PDHA1 |
Modifications | Phospho S293 |
Pyruvate Dehydrogenase E1 alpha Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human PDHA1 |
Pyruvate Dehydrogenase E1 alpha Rabbit monoclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |