Primary Antibodies

Jump to Filters
View as table Download
L3MBTL1 Rabbit Polyclonal Antibody
TA308637

USD 415.00

In Stock

Rabbit polyclonal antibody to L3MBTL (l(3)mbt-like (Drosophila))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 365 and 723 of L3MBTL
L3MBTL1 Rabbit Polyclonal Antibody
TA331951

USD 375.00

5 Days

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL Antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: RRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPE
L3MBTL1 Rabbit Polyclonal Antibody
TA339478

USD 375.00

5 Days

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS