Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Rabbit polyclonal ACHE Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE.

Rabbit Polyclonal Anti-ACHE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the middle region of human ACHE. Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA

Goat Polyclonal Antibody against ACHE

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1.

Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 551 and 614 of AChE (Uniprot ID#P22303)

Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303)

Rabbit polyclonal ACHE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ACHE.

Rabbit Polyclonal Anti-ACHE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACHE

ACHE Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 398-617 of human ACHE (NP_056646.1).
Modifications Unmodified