Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CRH Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH.

Rabbit Polyclonal Anti-CRH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM

Rabbit Polyclonal Anti-CRH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH

CRH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH

CRH Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1).
Modifications Unmodified