Rabbit polyclonal NR1D2 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-294 amino acids from the Central region of human NR1D2. |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the C terminal of human NR1D2. Synthetic peptide located within the following region: ETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP |
NR1D2 Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Immunogen | NR1D2 antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR1D2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Hamster, Elephant (89%); Mouse, Rat, Panda, Bat, Dog, Rabbit, Horse (84%). |
NR1D2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NR1D2 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NR1D2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Panda, Dog (94%); Bovine, Bat, Horse (88%); Elephant (81%). |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the middle region of human NR1D2. Synthetic peptide located within the following region: MSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFT |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the N terminal of human NR1D2. Synthetic peptide located within the following region: YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL |
Germany
Japan
United Kingdom
China
