Germany
Japan
United Kingdom
China
Rabbit anti-NRF1 Polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRF1 |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-NRF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NRF1. |
Rabbit polyclonal anti-NRF1 antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a purified recombinant mouse NRF1 protein corresponding to aa 1- 534 of the native protein. |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NRF1 Antibody is: synthetic peptide directed towards the middle region of Human NRF1. Synthetic peptide located within the following region: WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the C terminal of human NRF1. Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the N terminal of human NRF1. Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NRF1 |
Active filters
Target Symbol
- NRF1
Isotypes
- IgG