Primary Antibodies

Jump to Filters
View as table Download
PTF1A Goat Polyclonal Antibody
TA303246

USD 375.00

5 Days

Goat Polyclonal Antibody against PTF1A

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1.
PTF1A Rabbit Polyclonal Antibody
TA329416

USD 310.00

5 Days

Rabbit Polyclonal anti-PTF1A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV
PTF1A Rabbit Polyclonal Antibody
TA330585

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTF1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP
PTF1A Rabbit Polyclonal Antibody
TA342326

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ptf1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG