Primary Antibodies

View as table Download

Rabbit polyclonal YOD1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1.

YOD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human YOD1 (NP_061036.3).
Modifications Unmodified

YOD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human YOD1 (NP_061036.3).
Modifications Unmodified

Rabbit polyclonal anti-YOD1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human YOD1.

Rabbit Polyclonal Anti-Yod1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Yod1 Antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Yod1. Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ

Rabbit Polyclonal Anti-YOD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human YOD1. Synthetic peptide located within the following region: ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV