Goat Anti-PCBP1 (aa223-234) Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2. |
Goat Anti-PCBP1 (aa223-234) Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2. |
Rabbit polyclonal anti-SLU7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SLU7. |
Rabbit Polyclonal NCBP1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NCBP1 antibody was raised against a 17 amino acid peptide near the center of human NCBP1. |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Rabbit polyclonal Hsc70 (Hsp73) Antibody
Applications | IF, WB |
Reactivities | Hamster, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Amino acids 618-637 of human hsc70 |
Mouse Monoclonal anti-hnRNPK Antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against SAP130 / SF3B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3. |
Goat Polyclonal Antibody against XAB2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2. |
Goat Polyclonal Antibody against SF3B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1. |
Goat Polyclonal Antibody against SYF2
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AEIKQNLERGTAV, from the C Terminus of the protein sequence according to NP_056299. |
Rabbit polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 533 and 792 of SART1 (Uniprot ID#O43290) |
Chicken Polyclonal anti-HSPA1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length Human Hsp70 |
Mouse Monoclonal anti-HSPA1A Antibody
Applications | FC |
Reactivities | Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
Conjugation | Unconjugated |
Mouse Monoclonal SF3B4 Antibody (3A1)
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Goat Anti-LSM2 (aa33-46) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
Goat Anti-PCBP1 (aa234-247) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1. |
Rabbit polyclonal anti-BCAS2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BCAS2. |
Anti-HNRNPA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.190~194(S-S-S-Q-R)derived from Human hnRNP A1. |
Anti-HNRNPK Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 280 amino acids of human heterogeneous nuclear ribonucleoprotein K |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
Applications | WB |
Reactivities | Human, Lamprey, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Mouse Monoclonal hnRNP M1-M4 Antibody (1D8)
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BAT1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BAT1 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI8H1 (formerly 8H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI7G6 (formerly 7G6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIH mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |