Germany
Japan
United Kingdom
China
Goat Anti-PCBP1 (aa223-234) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2. |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-SLU7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SLU7. |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-hnRNPK Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against SAP130 / SF3B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3. |
Goat Polyclonal Antibody against XAB2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2. |
Goat Polyclonal Antibody against SF3B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1. |
Goat Polyclonal Antibody against SYF2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEIKQNLERGTAV, from the C Terminus of the protein sequence according to NP_056299. |
Rabbit polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 533 and 792 of SART1 (Uniprot ID#O43290) |
Chicken Polyclonal anti-HSPA1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length Human Hsp70 |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
Mouse Monoclonal SF3B4 Antibody (3A1)
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Goat Anti-LSM2 (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
Goat Anti-PCBP1 (aa234-247) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1. |
Rabbit polyclonal anti-BCAS2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BCAS2. |
Anti-HNRNPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.190~194(S-S-S-Q-R)derived from Human hnRNP A1. |
Anti-HNRNPK Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 280 amino acids of human heterogeneous nuclear ribonucleoprotein K |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
| Applications | WB |
| Reactivities | Human, Lamprey, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI7G6 (formerly 7G6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Pathways
- Spliceosome
Filter by
Category
Target Symbol
- HSPA1A (45)
- DDX39B (38)
- SF3A1 (35)
- SNRPB2 (35)
- HNRNPM (30)
- HSPA1L (26)
- SLU7 (26)
- PPIL1 (25)
- PCBP1 (17)
- HSPA8 (15)
- SRSF9 (15)
- PPIH (10)
- RBM8A (10)
- BCAS2 (7)
- SYF2 (6)
- SF3B6 (5)
- THOC3 (5)
- HNRNPC (4)
- HNRNPK (4)
- SART1 (3)
- SF3B4 (3)
- ACIN1 (2)
- ALYREF (2)
- CTNNBL1 (2)
- HNRNPA1 (2)
- NCBP1 (2)
- PRPF31 (2)
- PUF60 (2)
- RBMX (2)
- SF3B3 (2)
- BUD31 (1)
- CDC40 (1)
- CDC5L (1)
- DDX5 (1)
- LSM2 (1)
- LSM4 (1)
- MAGOH (1)
- PRPF18 (1)
- PRPF3 (1)
- SNRPE (1)
- SNW1 (1)
- SRSF1 (1)
- SRSF5 (1)
- U2AF1 (1)
- WBP11 (1)
- XAB2 (1)