Primary Antibodies

View as table Download

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3G3

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human
Conjugation Unconjugated

CHIA mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human
Conjugation Unconjugated