Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)

Rabbit anti-ARG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARG1

Goat Anti-Arginase I Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit polyclonal ARG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARG1.

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Goat Polyclonal Antibody against ARG1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit Polyclonal Anti-ARG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4H7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4D7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI3C8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI4D7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI4D7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI3C8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI3C8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARG1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated