Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI7B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI4F4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI10B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI2F8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated