Germany
Japan
United Kingdom
China
Anti-THPO Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 22-349 amino acids of human Thrombopoietin |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-THPO Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS |
Rabbit Polyclonal Anti-THPO Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP |
Thrombopoietin Rabbit Polyclonal (aa35-50) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | THPO / TPO / Thrombopoietin antibody was raised against synthetic peptide from human THPO / Thrombopoietin. |
Rabbit polyclonal anti-THPO (TPO) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human TPO |
Active filters
Target Symbol
- THPO
Pathways
- Hematopoietic cell lineage