Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-NCF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 190 amino acids of human neutrophil cytosolic factor 4, 40kDa |
Goat Polyclonal Antibody against NCF4 / P40PHOX
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KDFPEEDDPTN, from the internal region of the protein sequence according to NP_000622.2; NP_038202.1. |
Rabbit Polyclonal Anti-NCF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE |
Rabbit Polyclonal Anti-NCF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4. Synthetic peptide located within the following region: TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI3E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI4E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI2D4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
NCF4 mouse monoclonal antibody,clone OTI12H10
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI3E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI3E3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI3E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI1A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI1A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI4E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI4E5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI4E5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI4E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI2D4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI2D4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI2D4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI2D4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI3E8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCF4 mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI6H9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI6H9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- NCF4
Pathways
- Leukocyte transendothelial migration