Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-GRM6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the N terminal of human GRM6. Synthetic peptide located within the following region: AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL |
Rabbit Polyclonal Anti-mGluR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-mGluR6 Antibody: A synthesized peptide derived from human mGluR6 |
Rabbit Polyclonal Anti-GRM6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the middle region of human GRM6. Synthetic peptide located within the following region: EFWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAV |
Rabbit Polyclonal Anti-GRM6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6. Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL |
Active filters
Target Symbol
- GRM6
Pathways
- Neuroactive ligand-receptor interaction