Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ATF4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATF4

ATF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF4

Rabbit Polyclonal Anti-Atf4 Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR

Goat Polyclonal Antibody against ATF4

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666.

Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody

Applications WB
Reactivities H:S219, M:S218
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ATF-4.
Modifications Phospho-specific

ATF 4 (ATF4) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.

Rabbit Polyclonal Antibody against ATF4 (S245)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 220-252 amino acids from human ATF4.

Rabbit anti-ATF4 (Phospho-Ser245) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanATF4 around the phosphorylation site of serine 245 (N-R-SP-L-P).
Modifications Phospho-specific

Rabbit Polyclonal ATF4 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the Middle Region

Rabbit polyclonal ATF4(Ab-245) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245.

Rabbit polyclonal ATF-4 (Ab-219) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4.

Rabbit polyclonal ATF4 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4.

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI8F5

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI8F5

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF4 mouse monoclonal antibody, clone OTI8F5

Applications WB
Reactivities Human
Conjugation Unconjugated