Mouse Monoclonal HIF Prolyl Hydroxylase 3 Antibody (EG188e/d5)
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal HIF Prolyl Hydroxylase 3 Antibody (EG188e/d5)
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399). |
Goat Polyclonal Antibody against EGLN3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RLGKYYVKERSK, from the internal region of the protein sequence according to NP_071356.1. |
Rabbit Polyclonal EGLN3/PHD3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminus of humanPHD3/HIF Prolyl Hydroxylase 3. [LocusLink ID 112399] |
Rabbit Polyclonal Anti-EGLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT |
Mouse monoclonal Anti-PHD3 Clone EG188e/d5
Reactivities | Human |
Conjugation | Unconjugated |
Anti-EGLN3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |