Primary Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA327232

USD 275.00

3 Weeks

Rabbit anti-PRDX6 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX6
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA346592

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Peroxiredoxin 6 (PRDX6) Rabbit Monoclonal Antibody [Clone ID: EPR3755]
TA307267

USD 509.00

In Stock

Rabbit monoclonal antibody against Peroxiredoxin 6 (clone EPR3755 )

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody [Clone ID: 4A3]
AM31914PU-N

USD 440.00

2 Weeks

Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, clone 4A3, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA346591

USD 410.00

5 Days

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody
AM31704PU-N

USD 440.00

2 Weeks

Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, Purified

Applications ELISA, IHC, IP
Reactivities Human
Peroxiredoxin 6 (PRDX6) (C-term) Rabbit Polyclonal Antibody
AP17665PU-N

USD 450.00

2 Weeks

Peroxiredoxin 6 (PRDX6) (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PRDX6.
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
AP31423PU-N

USD 440.00

2 Weeks

Peroxiredoxin 6 (PRDX6) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Sulfonylated peptide (KLH coupled) corresponding to the active site sequence common to mammalian Prx VI
Peroxiredoxin 6 (PRDX6) Goat Polyclonal Antibody
TA326746

USD 375.00

5 Days

Goat Anti-peroxiredoxin 6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1.
Peroxiredoxin 6 (PRDX6) Goat Polyclonal Antibody
TA327774

USD 375.00

5 Days

PRDX6 Goat Polyclonal Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen internal region (TAEKRVATPVD)
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA321675

USD 345.00

In Stock

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA321676

USD 345.00

4 Weeks

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6