Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-EGR1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGR1/2. |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-EGR-1 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1. |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
Anti-EGR1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 87-337 amino acids of human early growth response 1early growth response 1 |
Active filters
Target Symbol
- EGR1
Reactivities
- Mouse
Pathways
- Prion diseases