Rabbit anti-IMPDH2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IMPDH2 |
Rabbit anti-IMPDH2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IMPDH2 |
Rabbit Polyclonal Anti-IMPDH2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD |
Goat Anti-IMPDH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KEEEHDCFLEEI, from the internal region of the protein sequence according to NP_000875.2. |
Rabbit Polyclonal Anti-IMPDH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the C terminal of human IMPDH2. Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF |
Carrier-free (BSA/glycerol-free) IMPDH2 mouse monoclonal antibody,clone OTI2F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IMPDH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IMPDH2 |
IMPDH2 mouse monoclonal antibody,clone OTI2F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IMPDH2 mouse monoclonal antibody,clone OTI2F10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IMPDH2 mouse monoclonal antibody,clone OTI2F10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
IMPDH2 mouse monoclonal antibody,clone OTI2F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |