Primary Antibodies

Jump to Filters
View as table Download
DDX5 Goat Polyclonal Antibody
TA302658

USD 375.00

In Stock

Goat Polyclonal Antibody against DDX5 / p68 RNA helicase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1.
DDX5 Rabbit Polyclonal Antibody
TA332589

USD 275.00

3 Weeks

Rabbit anti-DDX5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DDX5
DDX5 Rabbit Polyclonal Antibody
AP17277PU-N

USD 450.00

2 Weeks

DDX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5
DDX5 Rabbit Polyclonal Antibody
TA341564

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
DDX5 Rabbit Polyclonal Antibody
TA341565

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY