Rabbit Polyclonal TLR9 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9. |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9. |
Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9. |
TLR9 (1050-1100) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Rat Anti-Human CD289 (TLR9) Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TLR9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN |