Primary Antibodies

Jump to Filters
View as table Download
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA325030

USD 450.00

5 Days

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA326886

USD 380.00

3 Weeks

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA325029

USD 450.00

5 Days

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA336240

USD 375.00

5 Days

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA336241

USD 375.00

5 Days

Rabbit Polyclonal Anti-HK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4C5]
CF500856

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4D4]
CF500884

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hexokinase II (HK2) Rabbit Polyclonal Antibody
TA349617

USD 345.00

In Stock

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4C5]
TA500856

USD 379.00

In Stock

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Hexokinase II (HK2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C5]
TA500856AM

USD 420.00

4 Weeks

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin
Hexokinase II (HK2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]
TA500856BM

USD 420.00

4 Weeks

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4C5]
TA500856S

USD 159.00

2 Days

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4D4]
TA500884

USD 379.00

In Stock

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: OTI4D4]
TA500884S

USD 159.00

2 Days

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".