Primary Antibodies

View as table Download

MYLK3 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human MLCK.

MYLK3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 542-570aa) of human MLCK / MYLK3

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYLK3