Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Hmgcl Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Rabbit Polyclonal Anti-HMGCL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL