Mouse Monoclonal SREBP1 Antibody (2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat, Golden Syrian Hamster |
Conjugation | Unconjugated |
Mouse Monoclonal SREBP1 Antibody (2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat, Golden Syrian Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SREBF2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SREBF2 antibody was raised against a 15 amino acid peptide near the center of human SREBF2. |
Rabbit Polyclonal SREBP1 Antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Rabbit Polyclonal SREBP-1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of human SREBF1. Synthetic peptide located within the following region: AGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGS |
Rabbit Polyclonal SREBP-1 (Ser439) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 around the phosphorylation site of Serine 439 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR |
SREBF1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SREBF1 |
SREBP1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SREBF1 (NP_001005291.1). |
Modifications | Unmodified |
SREBP1 Rabbit polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from the Internal region of human SREBP-1. |