Primary Antibodies

View as table Download

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.

Factor VIII Sheep Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen F8 / FVIII / Factor VIII antibody was raised against human Factor VIIIC (F. VIII) purified from F. VIII concentrate.

Rabbit Polyclonal Factor VIII Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-F8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ

Mouse monoclonal Anti-Factor VIII:c light chain Clone RFF-VIII:c/5

Reactivities Human
Conjugation Unconjugated

Rabbit anti Coagulation Factor VIII (Fused form) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to fused portion of human FVIII protein surrounding to HQREI domain with depletion of cleavage terminus.

Rabbit anti Coagulation Factor VIII (Cleaved form, N-term) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to N-term of the cleavage form VLLKRHHQR of human FVIII protein. It also identical to mouse, chicken origin.

Rabbit anti Coagulation Factor VIII (Cleaved form, C-Term) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-term of the cleavage form around sequence EITRTTLQS of human FVIII protein. It also identical to mouse, chicken origin.

Factor VIII Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the C-terminal region of human Factor VIII. at AA rangle: 2130-2210