Rabbit Polyclonal Acetyl-Histone H4 (Lys5) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Acetyl-Histone H4 around the phosphorylation site of Lys5 |
Rabbit Polyclonal Histone H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Histone H4 |
Rabbit Polyclonal Anti-HIST1H4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |
Rabbit Polyclonal Anti-HIST4H4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HIST4H4 |
Germany
Japan
United Kingdom
China