Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

Rabbit polyclonal anti-Myosin antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 12-27 of human myosin light chain protein.

Carrier-free (BSA/glycerol-free) MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

MYL9 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2).
Modifications Unmodified

Phospho-MYL9-S19 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S19 of human Phospho-MYL9-S19 (NP_006088.2).
Modifications Phospho S19

Phospho-MYL9-T18/S19 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around of human Phospho-MYL9-T18/S19 .
Modifications Phospho T18/S19

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MYL9 mouse monoclonal antibody,clone OTI3H6, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MYL9 mouse monoclonal antibody,clone OTI3H6, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated