Rabbit Polyclonal Anti-Keratin 14 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 14 Antibody: A synthesized peptide derived from human Keratin 14 |
Rabbit Polyclonal Anti-Keratin 14 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 14 Antibody: A synthesized peptide derived from human Keratin 14 |
Rabbit Polyclonal Anti-KRT14 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT14 antibody: synthetic peptide directed towards the C terminal of human KRT14. Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN |
Mouse monoclonal Anti-Keratin14 Clone LL002
Reactivities | Human, Mouse, Pig |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT14 mouse monoclonal antibody,clone OTI3C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT14 mouse monoclonal antibody,clone OTI5F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT14 mouse monoclonal antibody, clone OTI4A7 (formerly 4A7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-KRT14 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 457-472 amino acids of Human Keratin, type I cytoskeletal 14 |
Anti-KRT14 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 457-472 amino acids of Human Keratin, type I cytoskeletal 14 |
Cytokeratin 14 (KRT14) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human Cytokeratin 14 (Cytokeratin 14 (KRT14)) (NP_000517.2). |
Modifications | Unmodified |
KRT14 mouse monoclonal antibody,clone OTI3C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT14 mouse monoclonal antibody,clone OTI3C7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT14 mouse monoclonal antibody,clone OTI3C7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
KRT14 mouse monoclonal antibody,clone OTI3C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KRT14 mouse monoclonal antibody,clone OTI5F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT14 mouse monoclonal antibody,clone OTI5F2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT14 mouse monoclonal antibody,clone OTI5F2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
KRT14 mouse monoclonal antibody,clone OTI5F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KRT14 mouse monoclonal antibody, clone OTI4A7 (formerly 4A7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
KRT14 mouse monoclonal antibody,clone 4A7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
KRT14 mouse monoclonal antibody,clone 4A7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
KRT14 mouse monoclonal antibody, clone OTI4A7 (formerly 4A7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |