Rabbit Polyclonal ST2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ST2 antibody was raised against a synthetic peptide corresponding to 16 amino acids at the amino-terminus of mouse ST2. This peptide is common to all three known ST2 isoforms. |
Rabbit Polyclonal Anti-IL1RL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC |
Il1rl1 (Extracell. Dom.) rat monoclonal antibody, clone 3F22, Purified
| Applications | WB |
| Reactivities | Mouse |
Rabbit Polyclonal IL1RL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 207-238 of human ST2V was used as immunogen, GenBank no BAA85894. |
Anti-IL1RL1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1 |
IL1RL1 Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse IL1RL1 |
ST2 Capture Mouse Monoclonal antibody, clone OTI6E12
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
ST2 HRP-Conjugated detection Mouse Monoclonal antibody, clone OTI21A7
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
