Primary Antibodies

View as table Download

PSME3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME3

Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3

Rabbit Polyclonal Anti-PSME3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSME3 antibody is: synthetic peptide directed towards the N-terminal region of Human PSME3. Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Rabbit Polyclonal Anti-PSME3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME3 antibody: synthetic peptide directed towards the C terminal of human PSME3. Synthetic peptide located within the following region: TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

PSME3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PSME3

PSME3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PSME3 (NP_005780.2).
Modifications Unmodified