Primary Antibodies

View as table Download

Goat Anti-SLC6A3 / DAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1.

Rabbit Polyclonal Anti-Dopamine Transporter (DAT) (extracellular)

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DAHASNSSDGLGLND, corresponding to amino acids residues 191-205 of rat Dopamine Transporter. Extracellular, 2nd loop.

Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH

Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A3

SLC6A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A3

SLC6A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A3

Dopamine Transporter/SLC6A3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC6A3 (NP_001035.1).
Modifications Unmodified