Primary Antibodies

View as table Download

Goat Polyclonal Anti-CB1 (isoform a) Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2.

Rabbit Polyclonal Anti-Cannabinoid Receptor 1 (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NKSLSSFKENEENIQC, corresponding to amino acid residues 84-99 of rat CB1 receptor. Extracellular, N-terminus.

Rabbit anti-CNR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Recombinant protein of human CNR1

Goat Polyclonal Antibody against Cannabinoid Receptor 1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTSEDGKVQVTRPDQ, from the internal region of the protein sequence according to NP_057167.2; NP_149421.1.

Rabbit Polyclonal Anti-CNR1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen CNR1 / CB1 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CNR1 / CB1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Hamster, Panda, Dog, Bat, Cat, Horse (100%); Marmoset, Pig, Turkey, Zebra finch, Chicken (95%); Opossum, Platypus (90%); Bovine, Lizard (85%).

Rabbit Polyclonal Anti-CNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNR1 antibody: synthetic peptide directed towards the N terminal of human CNR1. Synthetic peptide located within the following region: ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL

Cnr1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

CNR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNR1

CNR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNR1