Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CTCFL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: CREKDHRSPSELEAERTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTV

Rabbit polyclonal anti-BORIS antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 9-26 of human BORIS protein.

Rabbit Polyclonal Anti-CTCFL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD

Mouse monoclonal Anti-BORIS Clone 4A7

Applications WB
Reactivities Human
Conjugation Unconjugated

CTCFL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CTCFL (NP_001255970.1).
Modifications Unmodified