Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EGLN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN

Rabbit Polyclonal Anti-EGLN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the middle region of human EGLN2. Synthetic peptide located within the following region: AVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIF

EGLN2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human EGLN2

EGLN2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 95-123 amino acids from the N-terminal region of human EGLN2

Rabbit Polyclonal Anti-EGLN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EGLN2 Antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL

Mouse monoclonal Anti-PHD1 Clone PHD112/G7

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EGLN2 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Egln2 Antibody - C-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).
Modifications Unmodified

Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).
Modifications Unmodified

PHD1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PHD1/prolyl hydroxylase

EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EGLN2 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EGLN2 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

EGLN2 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

EGLN2 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated