ETS2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 152~182 amino acids from the Central region of Human ETS2. |
ETS2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 152~182 amino acids from the Central region of Human ETS2. |
Rabbit Polyclonal Anti-ETS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2. Synthetic peptide located within the following region: NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQE |
Rabbit Polyclonal Anti-ETS2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ETS2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ETS2 |
ETS2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ETS2 |
ETS2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 165-345 of human ETS2 (NP_005230.1). |
Modifications | Unmodified |
ETS2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ETS2. |
ETS2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ETS2. |
ETS2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-350 of human ETS2 (NP_005230.1). |
Modifications | Unmodified |
ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3E10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3E10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 1H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 1H4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 2A3, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 2A3, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3B9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3B9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3C4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3C4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |