Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HEMGN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEMGN antibody: synthetic peptide directed towards the N terminal of human HEMGN. Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Carrier-free (glycerol/BSA-free) HEMGN mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

HEMGN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of Human HEMGN.
Modifications Unmodified

HEMGN mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HEMGN mouse monoclonal antibody,clone UMAB169

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated