Rabbit Polyclonal Anti-PCBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
Rabbit Polyclonal Anti-PCBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM |
PCBP1 mouse monoclonal antibody, clone AT2A10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PCBP1 mouse monoclonal antibody, clone AT2A10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Goat Anti-PCBP1 (aa223-234) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2. |
Goat Anti-PCBP1 (aa234-247) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1. |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
hnRNP E1/PCBP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human hnRNP E1/hnRNP E1/PCBP1 (NP_006187.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
