Primary Antibodies

View as table Download

RRAS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RRAS

Rabbit Polyclonal Anti-RRAS Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rras antibody is: synthetic peptide directed towards the C-terminal region of Rat Rras. Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

RRAS (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 98-131 amino acids from the Central region of Human RRAS.

Carrier-free (BSA/glycerol-free) RRAS mouse monoclonal antibody,clone OTI2B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RRAS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RRAS

RRAS Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

RRAS mouse monoclonal antibody,clone OTI2B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RRAS mouse monoclonal antibody,clone OTI2B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated