Primary Antibodies

View as table Download

Rabbit polyclonal Anti-SH3BP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

SH3BP2 sheep polyclonal antibody, Purified

Applications WB
Reactivities Mouse
Immunogen Antibody developed using SH2 domain of the 3BP2 protein fused to GST.

SH3BP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 150-180 amino acids from the Central region of Human SH3BP2

SH3BP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 392-561 of human SH3BP2 (NP_001116153.1).
Modifications Unmodified