Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal HP1alpha/beta/gamma Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms. |
Rabbit Polyclonal Anti-CBX5 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
| Modifications | Unmodified |
HP1 alpha Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HP1 alpha |
Active filters
Target Symbol
- CBX5
Applications
- IF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal