Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Protease
Availabilities
- In Stock
Filter by
Target Symbol
- CASP7 (5)
- CASP9 (5)
- CFLAR (4)
- MME (4)
- CASP1 (3)
- SENP1 (3)
- ABHD12 (2)
- ACY1 (2)
- ADAM2 (2)
- ADAM20 (2)
- ADAMTS1 (2)
- ADAMTS16 (2)
- ADAMTS6 (2)
- ATG4B (2)
- ATG4C (2)
- CAPNS1 (2)
- CASP10 (2)
- CASP3 (2)
- CTSB (2)
- CTSE (2)
- CTSK (2)
- CTSZ (2)
- EPHX1 (2)
- F7 (2)
- GZMK (2)
- HP (2)
- KLK3 (2)
- MMP10 (2)
- MMP14 (2)
- MMP19 (2)
- MMP2 (2)
- MMP9 (2)
- MYSM1 (2)
- NAPSA (2)
- PARK7 (2)
- PLAU (2)
- PRCP (2)
- PRSS50 (2)
- PSEN1 (2)
- PSMD14 (2)
- SENP3 (2)
- TPP1 (2)
- ABHD5 (1)
- ACE (1)
- ACR (1)
- ADAM10 (1)
- ADAM15 (1)
- ADAM17 (1)
- ADAM21 (1)
- ADAM28 (1)
- ADAM32 (1)
- ADAMTS18 (1)
- ADAMTS19 (1)
- ADAMTS5 (1)
- AEBP1 (1)
- AGA (1)
- ANPEP (1)
- APEH (1)
- ATG4A (1)
- BACE1 (1)
- BACE2 (1)
- C1S (1)
- CAPN1 (1)
- CAPN7 (1)
- CASP2 (1)
- CASP6 (1)
- CNDP1 (1)
- COPS5 (1)
- CPA2 (1)
- CPB1 (1)
- CTSC (1)
- CTSD (1)
- CTSH (1)
- CTSL (1)
- CTSV (1)
- DHH (1)
- DPP4 (1)
- ECE1 (1)
- ENPEP (1)
- F10 (1)
- F12 (1)
- F2 (1)
- F9 (1)
- GGT1 (1)
- GZMB (1)
- HGF (1)
- HTRA3 (1)
- IHH (1)
- KEL (1)
- KLK1 (1)
- KLK11 (1)
- KLK14 (1)
- KLK5 (1)
- KLK6 (1)
- LONP1 (1)
- LONP2 (1)
- LTA4H (1)
- LTF (1)
- MALT1 (1)
- MASP2 (1)
Reactivities
Isotypes
Modifications
Pathways
- Alzheimer's disease (25)
- Apoptosis (20)
- Lysosome (18)
- Pathways in cancer (15)
- Parkinson's disease (12)
- Complement and coagulation cascades (11)
- Amyotrophic lateral sclerosis (ALS) (10)
- Huntington's disease (9)
- Metabolic pathways (9)
- Colorectal cancer (7)
- Prostate cancer (7)
- Renin-angiotensin system (7)
- Viral myocarditis (7)
- p53 signaling pathway (7)
- Hematopoietic cell lineage (6)
- Bladder cancer (5)
- Endometrial cancer (5)
- Non-small cell lung cancer (5)
- Pancreatic cancer (5)
- Proteasome (5)
- Regulation of autophagy (5)
- Small cell lung cancer (5)
- VEGF signaling pathway (5)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- GnRH signaling pathway (4)
- Leukocyte transendothelial migration (4)
- Antigen processing and presentation (3)
- Cytosolic DNA-sensing pathway (3)
- NOD-like receptor signaling pathway (3)
- Natural killer cell mediated cytotoxicity (3)
- Notch signaling pathway (3)
- Wnt signaling pathway (3)
- Arachidonic acid metabolism (2)
- Arginine and proline metabolism (2)
- Cardiac muscle contraction (2)
- Glutathione metabolism (2)
- Hedgehog signaling pathway (2)
- MAPK signaling pathway (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Neuroactive ligand-receptor interaction (2)
- Neurotrophin signaling pathway (2)
- Oxidative phosphorylation (2)
- RIG-I-like receptor signaling pathway (2)
- Allograft rejection (1)
- Autoimmune thyroid disease (1)
- B cell receptor signaling pathway (1)
- Cyanoamino acid metabolism (1)
- Cytokine-cytokine receptor interaction (1)
- Endocytosis (1)
- Focal adhesion (1)
- Glycerolipid metabolism (1)
- Graft-versus-host disease (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Melanoma (1)
- Other glycan degradation (1)
- PPAR signaling pathway (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Selenoamino acid metabolism (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- Taurine and hypotaurine metabolism (1)
- Type I diabetes mellitus (1)
- beta-Alanine metabolism (1)