Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NCF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NCF2 |
Rabbit Polyclonal Anti-MAPK12 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPK12 |
Rabbit Polyclonal Anti-CLDN2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLDN2 |
Rabbit Polyclonal Anti-CLDN8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLDN8 |
Rabbit Polyclonal Anti-MAPK11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK11 |
Rabbit Polyclonal Anti-MAPK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK13 |
Rabbit Polyclonal Anti-CDH5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDH5 |
Rabbit Polyclonal Anti-PRKCG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCG |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
USD 345.00
In Stock
NOX3 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Leukocyte transendothelial migration
Filter by
Target Symbol
- CTNNB1 (14)
- MAPK14 (13)
- VASP (12)
- CXCR4 (11)
- PTK2 (11)
- MMP9 (9)
- PIK3R1 (9)
- PXN (9)
- ACTB (8)
- PRKCA (8)
- CLDN7 (7)
- CXCL12 (7)
- MMP2 (7)
- ROCK2 (7)
- ACTN2 (6)
- CLDN1 (6)
- MSN (6)
- NCF1 (6)
- PTPN11 (6)
- BCAR1 (5)
- PECAM1 (5)
- PTK2B (5)
- SHC1 (5)
- CDH5 (4)
- CLDN2 (4)
- CLDN5 (4)
- CTNNA1 (4)
- ICAM1 (4)
- ITGA4 (4)
- ITGB1 (4)
- NOX3 (4)
- PIK3CG (4)
- ROCK1 (4)
- ACTN1 (3)
- ACTN3 (3)
- ACTN4 (3)
- CLDN10 (3)
- CLDN11 (3)
- CLDN23 (3)
- CLDN3 (3)
- CLDN4 (3)
- CTNND1 (3)
- CYBB (3)
- ITGAM (3)
- ITGB2 (3)
- PIK3CD (3)
- PLCG1 (3)
- SIPA1 (3)
- VCL (3)
- ACTG1 (2)
- CD99 (2)
- CLDN19 (2)
- CLDN8 (2)
- EZR (2)
- F11R (2)
- ITGAL (2)
- MLLT4 (2)
- MYL9 (2)
- NCF2 (2)
- NOX1 (2)
- PIK3CA (2)
- PIK3R3 (2)
- PIK3R5 (2)
- PRKCB (2)
- RAP1A (2)
- RAP1B (2)
- RAPGEF3 (2)
- VAV2 (2)
- VCAM1 (2)
- ARHGAP5 (1)
- CDC42 (1)
- CLDN16 (1)
- CLDN17 (1)
- CLDN6 (1)
- CYBA (1)
- GNAI1 (1)
- GNAI3 (1)
- ITK (1)
- JAM2 (1)
- MAPK11 (1)
- MAPK12 (1)
- MAPK13 (1)
- MYL12A (1)
- MYL12B (1)
- MYL2 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PLCG2 (1)
- PRKCG (1)
- RAC1 (1)
- RAPGEF4 (1)
- RHOH (1)
- THY1 (1)
- VAV1 (1)