Antibodies

Jump to Filters
View as table Download
EIF4EL3 (EIF4E2) Rabbit Polyclonal Antibody
TA345899

USD 410.00

5 Days

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY
EIF4EL3 (EIF4E2) Rabbit Polyclonal Antibody
TA302039

USD 450.00

In Stock

Rabbit Polyclonal Antibody against EIF4E2 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2.