Antibodies

Jump to Filters
View as table Download
BMP6 Rabbit Polyclonal Antibody
AP20577PU-N

USD 370.00

2 Weeks

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 370.00

2 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP4 Rabbit Polyclonal Antibody
AP22650PU-N

USD 530.00

2 Weeks

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA349051

USD 484.00

5 Days

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 424.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
BMP7 Rabbit Polyclonal Antibody
AP20768PU-N

USD 407.00

2 Weeks

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7
BMP7 Rabbit Polyclonal Antibody
TA328272

USD 285.00

5 Days

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7
BMP5 Rabbit Polyclonal Antibody
AP20581PU-N

USD 407.00

2 Weeks

BMP5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
SMURF 2 (SMURF2) (N-term) Rabbit Polyclonal Antibody
AP11954PU-N

USD 450.00

2 Weeks

SMURF 2 (SMURF2) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SMURF2.
GDF 5 (GDF5) (C-term) Rabbit Polyclonal Antibody
AP51811PU-N

USD 450.00

2 Weeks

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5
BMP7 Rabbit Polyclonal Antibody
TA330253

USD 310.00

5 Days

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
BMP8B Rabbit Polyclonal Antibody
AP20771PU-N

USD 370.00

2 Weeks

BMP8B rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
BMP5 Rabbit Polyclonal Antibody
TA316572

USD 425.00

5 Days

BMP5 Rabbit Polyclonal (aa31-46) Antibody

Applications IHC
Reactivities Human
Immunogen BMP5 antibody was raised against synthetic peptide from human BMP5.
BMP2 Rabbit Polyclonal Antibody
TA328271

USD 285.00

5 Days

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2
BMP4 Rabbit Polyclonal Antibody
TA323208

USD 345.00

In Stock

Anti-BMP4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
BMP4 Rabbit Polyclonal Antibody
TA323209

USD 345.00

4 Weeks

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA350762

USD 345.00

In Stock

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMURF2
BMP6 Rabbit Polyclonal Antibody
TA351009

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6