Antibodies

Jump to Filters
View as table Download
GLI1 Rabbit Monoclonal Antibody [Clone ID: EPR4523]
TA310536

USD 509.00

In Stock

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
GLI1 Rabbit Polyclonal Antibody
TA309673

USD 457.00

In Stock

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 370.00

2 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP4 Rabbit Polyclonal Antibody
AP22650PU-N

USD 530.00

2 Weeks

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4
GLI3 Rabbit Polyclonal Antibody
TA319303

USD 530.00

2 Weeks

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 424.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
GLI2 Rabbit Polyclonal Antibody
TA329437

USD 310.00

5 Days

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE
GLI2 Rabbit Polyclonal Antibody
TA336950

USD 424.00

2 Weeks

Rabbit Polyclonal GLI-2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli2 protein (between residues 300-400) [UniProt P10070]
GLI3 Rabbit Polyclonal Antibody
TA313928

USD 345.00

4 Weeks

Rabbit polyclonal anti-GLI-3 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3.
BMP2 Rabbit Polyclonal Antibody
TA328271

USD 285.00

5 Days

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2
BMP4 Rabbit Polyclonal Antibody
TA323208

USD 345.00

In Stock

Anti-BMP4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
BMP4 Rabbit Polyclonal Antibody
TA323209

USD 345.00

4 Weeks

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
GLI3 Rabbit Polyclonal Antibody
TA355523

USD 360.00

5 Days

GLI3 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC